MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MFNG.

Brand:  Abnova H00004242-A01.50uL

Product Code. 16191205

Description

This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. [provided by RefSeq

Sequence: WASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGP

Specifications

• Antigen: MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant MFNG.
• Gene: MFNG
• Gene Symbols: MFNG
• Immunogen: MFNG (NP_002396, 214 a.a. ∼ 291 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002405
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 4242
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.