muscleblind-like (Drosophila), Mouse, Clone: 1D11, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant MBNL1.

Brand:  Abnova H00004154-M01.100ug

Product Code. 16177631

Description

Sequence: MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

Specifications

• Antigen: muscleblind-like (Drosophila)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC050535
• Gene Symbols: MBNL1
• Immunogen: MBNL1 (AAH50535, 1 a.a. ∼ 343 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 4154
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 1D11
• Description: Mouse monoclonal antibody raised against a full length recombinant MBNL1.
• Gene: MBNL1
• Gene Alias: DKFZp686P06174/EXP/EXP35/EXP40/EXP42/KIAA0428/MBNL
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody