ret finger protein-like 4B, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RFPL4B.

Brand:  Abnova H00442247-A01.50uL

Artikelnummer. 16152997

Beschreibung

Sequence: TKDPRLACVLGTPCFSSGQHYWEVEVGEVKSWSLGVCKEPADRKSNDLFPGHGFWISMKAGAIHANTHLERIPASPRLRRVGIFLDADLEEIQFFDVDNN

Spezifikation

• Antigen: ret finger protein-like 4B
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant RFPL4B.
• Gene: RFPL4B
• Gene Alias: RNF211
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Ubiquitin/Proteasome
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001013734
• Gene Symbols: RFPL4B
• Immunogen: RFPL4B (NP_001013756, 127 a.a. ∼ 226 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 442247
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.