LIM domain only 4, Mouse, Clone: 3B4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant LMO4.

Brand:  Abnova H00008543-M04.100ug

Product Code. 16148775

Description

This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. [provided by RefSeq

Sequence: LGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC

Specifications

• Antigen: LIM domain only 4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006769
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 3B4
• Description: Mouse monoclonal antibody raised against a full length recombinant LMO4.
• Gene: LMO4
• Gene Symbols: LMO4
• Immunogen: LMO4 (NP_006760, 57 a.a. ∼ 165 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 8543
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ