LIM homeobox 6, Mouse, Clone: 3E8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant LHX6.

Brand:  Abnova H00026468-M05.100ug

Product Code. 16115496

Description

This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq

Sequence: HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY

Specifications

• Antigen: LIM homeobox 6
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_014368
• Gene Symbols: LHX6
• Immunogen: LHX6 (NP_055183, 274 a.a. ∼ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 3E8
• Description: Mouse monoclonal antibody raised against a partial recombinant LHX6.
• Gene: LHX6
• Gene Alias: LHX6.1/MGC119542/MGC119544/MGC119545
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 26468
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ