leucine zipper-EF-hand containing transmembrane protein 1, Mouse, Clone: 6F7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant LETM1.

Brand:  Abnova H00003954-M03.100ug

Product Code. 16180635

Description

Sequence: ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA

Specifications

• Antigen: leucine zipper-EF-hand containing transmembrane protein 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_012318
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3954
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Clone: 6F7
• Description: Mouse monoclonal antibody raised against a partial recombinant LETM1.
• Gene: LETM1
• Gene Symbols: LETM1
• Immunogen: LETM1 (NP_036450, 601 a.a. ∼ 708 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody