LAG1 homolog, ceramide synthase 6, Mouse, Clone: 6B8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant LASS6.

Brand:  Abnova H00253782-M02.100ug

Product Code. 16192577

Description

Sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR

Specifications

• Antigen: LAG1 homolog, ceramide synthase 6
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_203463
• Gene Symbols: LASS6
• Immunogen: LASS6 (NP_982288, 62 a.a. ∼ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 253782
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ

• Applications: ELISA, Western Blot
• Clone: 6B8
• Description: Mouse monoclonal antibody raised against a partial recombinant LASS6.
• Gene: LASS6
• Gene Alias: CerS6/MGC129949/MGC129950
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody