interleukin-1 receptor-associated kinase 2, Mouse, Clone: 3H1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant IRAK2.

Brand:  Abnova H00003656-M03.100ug

Product Code. 16100225

Description

IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB. [provided by RefSeq

Sequence: KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF

Specifications

• Antigen: interleukin-1 receptor-associated kinase 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001570
• Gene Symbols: IRAK2
• Immunogen: IRAK2 (NP_001561, 111 a.a. ∼ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 3H1
• Description: Mouse monoclonal antibody raised against a partial recombinant IRAK2.
• Gene: IRAK2
• Gene Alias: IRAK-2/MGC150550
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3656
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ