inducible T-cell co-stimulator, Mouse, Clone: 1G1, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant ICOS.

Brand:  Abnova H00029851-M01.50ug

Product Code. 16169122

Description

The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. [provided by RefSeq

Sequence: MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKM

Specifications

• Antigen: inducible T-cell co-stimulator
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC028006
• Gene Symbols: ICOS
• Immunogen: ICOS (AAH28006, 1 a.a. ∼ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 50 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 29851
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ

• Applications: ELISA
• Clone: 1G1
• Description: Mouse monoclonal antibody raised against a full-length recombinant ICOS.
• Gene: ICOS
• Gene Alias: AILIM/CD278/MGC39850
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody