hydroxysteroid (17-beta) dehydrogenase 12 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant HSD17B12.

Brand:  Abnova H00051144-A01.50uL

Product Code. 16196636

Description

The enzyme 17-beta hydroxysteroid dehydrogenase-12 (HSD17B12) uses NADPH to reduce 3-ketoacyl-CoA to 3-hydroxyacyl-CoA during the second step of fatty acid elongation.[supplied by OMIM

Sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG

Specifications

• Antigen: hydroxysteroid (17-beta) dehydrogenase 12
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant HSD17B12.
• Gene: HSD17B12
• Gene Alias: KAR/SDR12C1
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 51144
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_016142
• Gene Symbols: HSD17B12
• Immunogen: HSD17B12 (NP_057226, 203 a.a. ∼ 271 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum