homeobox C12, Mouse, Clone: 1C6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HOXC12.

Brand:  Abnova H00003228-M01.100ug

Product Code. 16139554

Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq

Sequence: MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDGKGYYREPCA

Specifications

• Antigen: homeobox C12
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_173860
• Gene Symbols: HOXC12
• Immunogen: HOXC12 (NP_776272, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 1C6
• Description: Mouse monoclonal antibody raised against a partial recombinant HOXC12.
• Gene: HOXC12
• Gene Alias: HOC3F/HOX3/HOX3F
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3228
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ