GTP binding protein 1 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GTPBP1.

Brand:  Abnova H00009567-A01.50uL

Product Code. 16160926

Description

This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype. [provided by RefSeq

Sequence: MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV

Specifications

• Antigen: GTP binding protein 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant GTPBP1.
• Gene: GTPBP1
• Gene Alias: GP-1/GP1/HSPC018/MGC20069
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 9567
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004286
• Gene Symbols: GTPBP1
• Immunogen: GTPBP1 (NP_004277, 1 a.a. ∼ 76 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum