G protein-coupled receptor kinase 4, Mouse, Clone: 6D5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GRK4.

Brand:  Abnova H00002868-M02.100ug

Product Code. 16138854

Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension. [provided by RefSeq

Sequence: LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE

Specifications

• Antigen: G protein-coupled receptor kinase 4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_182982
• Gene Symbols: GRK4
• Immunogen: GRK4 (NP_892027, 36 a.a. ∼ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 6D5
• Description: Mouse monoclonal antibody raised against a partial recombinant GRK4.
• Gene: GRK4
• Gene Alias: GPRK2L/GPRK4/GRK4a/IT11
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 2868
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ