GLO1, Mouse, Clone: 4C12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GLO1.

Brand:  Abnova H00002739-M01.100ug

Product Code. 16168724

Description

The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutathione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere. [provided by RefSeq

Sequence: MAEPQPPSGGLTDEAALSYCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKAT

Specifications

• Antigen: GLO1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC011365
• Gene Symbols: GLO1
• Immunogen: GLO1 (AAH11365.1, 1 a.a. ∼ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA
• Clone: 4C12
• Description: Mouse monoclonal antibody raised against a partial recombinant GLO1.
• Gene: GLO1
• Gene Alias: GLOD1/GLYI
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2739
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid