growth differentiation factor 11, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GDF11.

Brand:  Abnova H00010220-A01.50uL

Product Code. 16102176

Description

The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development. [provided by RefSeq

Sequence: ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Specifications

• Antigen: growth differentiation factor 11
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant GDF11.
• Gene: GDF11
• Gene Alias: BMP-11/BMP11
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cytokines
• Gene ID (Entrez): 10220
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005811
• Gene Symbols: GDF11
• Immunogen: GDF11 (NP_005802, 310 a.a. ∼ 407 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum