GBA, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GBA.

Brand:  Abnova H00002629-A01.50uL

Product Code. 16188554

Description

This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq

Sequence: SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS

Specifications

• Antigen: GBA
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant GBA.
• Gene: GBA
• Gene Alias: GBA1/GCB/GLUC
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_000157
• Gene Symbols: GBA
• Immunogen: GBA (NP_000148, 146 a.a. ∼ 235 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 2629
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.