FXN, Mouse, Clone: 1D9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FXN.

Brand:  Abnova H00002395-M01.100ug

Product Code. 16178314

Description

This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL

Specifications

• Antigen: FXN
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000144
• Gene Symbols: FXN
• Immunogen: FXN (AAH48097.1, 91 a.a. ∼ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 1D9
• Description: Mouse monoclonal antibody raised against a partial recombinant FXN.
• Gene: FXN
• Gene Alias: CyaY/FA/FARR/FRDA/MGC57199/X25
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2395
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid