FOXF2, Mouse, Clone: 2F5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FOXF2.

Brand:  Abnova H00002295-M06.100ug

Product Code. 16108184

Description

FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by RefSeq

Sequence: SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV

Specifications

• Antigen: FOXF2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001452
• Gene Symbols: FOXF2
• Immunogen: FOXF2 (NP_001443, 346 a.a. ∼ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 2F5
• Description: Mouse monoclonal antibody raised against a partial recombinant FOXF2.
• Gene: FOXF2
• Gene Alias: FKHL6/FREAC2
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2295
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid