fragile histidine triad gene, Mouse, Clone: 1E3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FHIT.

Brand:  Abnova H00002272-M03.100ug

Product Code. 16138134

Description

This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5‴-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. [provided by RefSeq]

Sequence: VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR

Specifications

• Antigen: fragile histidine triad gene
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC032336
• Gene Symbols: FHIT
• Immunogen: FHIT (AAH32336, 31 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Endocrine/Metabolism
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 1E3
• Description: Mouse monoclonal antibody raised against a partial recombinant FHIT.
• Gene: FHIT
• Gene Alias: AP3Aase/FRA3B
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 2272
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ