FHIT, Mouse, Clone: 1A2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FHIT.

Brand:  Abnova H00002272-M02A.200uL

Product Code. 16128134

Description

This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5‴-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. [provided by RefSeq]

Sequence: VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR

Specifications

• Antigen: FHIT
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC032336
• Gene Symbols: FHIT
• Immunogen: FHIT (AAH32336, 31 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 2272
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 1A2
• Description: Mouse monoclonal antibody raised against a partial recombinant FHIT.
• Gene: FHIT
• Gene Alias: AP3Aase/FRA3B
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ