fibroblast growth factor 19, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human FGF19 protein.

Brand:  Abnova H00009965-B01.50uL

Product Code. 16144292

Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq

Sequence: MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Specifications

• Antigen: fibroblast growth factor 19
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human FGF19 protein.
• Gene: FGF19
• Gene Symbols: FGF19
• Immunogen: FGF19 (AAH17664, 1 a.a. ∼ 216 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 9965
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC017664
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Neurobiology
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum