FABP7, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant FABP7.

Brand:  Abnova H00002173-A01.50uL

Product Code. 16164811

Description

The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. [provided by RefSeq

Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

Specifications

• Antigen: FABP7
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length recombinant FABP7.
• Gene: FABP7
• Gene Alias: B-FABP/BLBP/DKFZp547J2313/FABPB/MRG
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC012299
• Gene Symbols: FABP7
• Immunogen: FABP7 (AAH12299, 1 a.a. ∼ 132 a.a) full-length recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 2173
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.