estrogen receptor 2 (ER beta), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ESR2.

Brand:  Abnova H00002100-A01.50uL

Product Code. 16147804

Description

This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized. [provided by RefSeq

Sequence: ILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNR

Specifications

• Antigen: estrogen receptor 2 (ER beta)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ESR2.
• Gene: ESR2
• Gene Alias: ER-BETA/ESR-BETA/ESRB/ESTRB/Erb/NR3A2
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001437
• Gene Symbols: ESR2
• Immunogen: ESR2 (NP_001428, 22 a.a. ∼ 121 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 2100
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.