EPOR, Mouse, Clone: 3D10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EPOR.

Brand:  Abnova H00002057-M01.100ug

Product Code. 16127754

Beschreibung

The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. [provided by RefSeq

Sequence: PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGA

Spezifikation

• Antigen: EPOR
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000121
• Gene Symbols: EPOR
• Immunogen: EPOR (NP_000112, 31 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 3D10
• Description: Mouse monoclonal antibody raised against a partial recombinant EPOR.
• Gene: EPOR
• Gene Alias: MGC138358
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2057
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid