dual specificity phosphatase 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant DUSP1.

Brand:  Abnova H00001843-A01.50uL

Product Code. 16003915

Description

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the nonreceptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. [provided by RefSeq

Sequence: LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC

Specifications

• Antigen: dual specificity phosphatase 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant DUSP1.
• Gene: DUSP1
• Gene Alias: CL100/HVH1/MKP-1/MKP1/PTPN10
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Cycle
• Gene ID (Entrez): 1843
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004417
• Gene Symbols: DUSP1
• Immunogen: DUSP1 (NP_004408, 305 a.a. ∼ 367 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum