DLX2, Mouse, Clone: 2C8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DLX2.

Brand:  Abnova H00001746-M06.100ug

Product Code. 16023905

Description

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 2. [provided by RefSeq

Sequence: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDL

Specifications

• Antigen: DLX2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004405.3
• Gene Symbols: DLX2
• Immunogen: DLX2 (NP_004396.1, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 2C8
• Description: Mouse monoclonal antibody raised against a partial recombinant DLX2.
• Gene: DLX2
• Gene Alias: TES-1/TES1
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1746
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid