Learn More
DLX1, Mouse, Clone: 4H7, Abnova™
Mouse monoclonal antibody raised against a full-length recombinant DLX1.
Brand: Abnova H00001745-M14.100ug
Description
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Sequence: SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQL*Specifications
| DLX1 | |
| Monoclonal | |
| Unconjugated | |
| PBS with no preservative; pH 7.4 | |
| NM_178120 | |
| Mouse | |
| Affinity chromatography | |
| RUO | |
| 1745 | |
| Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| Liquid |
| ELISA, Immunoprecipitation, Western Blot | |
| 4H7 | |
| Mouse monoclonal antibody raised against a full length recombinant DLX1. | |
| DLX1 | |
| DLX1 | |
| DLX1 (NP_835221, 181 a.a. ∼ 254 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG2a κ |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.