chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CXCL6 protein.

Brand:  Abnova H00006372-D01P.100ug

Product Code. 16115065

Description

Sequence: MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

Specifications

• Antigen: chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CXCL6 protein.
• Gene: CXCL6
• Gene Alias: CKA-3/GCP-2/GCP2/SCYB6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002993
• Gene Symbols: CXCL6
• Immunogen: CXCL6 (NP_002984.1, 1 a.a. ∼ 114 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Gene ID (Entrez): 6372
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG