chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1), Mouse, Clone: 1F10, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CXCL12.

Brand:  Abnova H00006387-M03.100ug

Product Code. 16100642

Description

For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM

Sequence: MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Specifications

• Antigen: chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC039893
• Gene Symbols: CXCL12
• Immunogen: CXCL12 (AAH39893.1, 1 a.a. ∼ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Adhesion
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA
• Clone: 1F10
• Description: Mouse monoclonal antibody raised against a full length recombinant CXCL12.
• Gene: CXCL12
• Gene Alias: PBSF/SCYB12/SDF-1a/SDF-1b/SDF1/SDF1A/SDF1B/TLSF-a/TLSF-b/TPAR1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6387
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ