CRMP1, Mouse, Clone: 2B6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CRMP1.

Brand:  Abnova H00001400-M50.100ug

Product Code. 16063845

Description

This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: HVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVIL

Specifications

• Antigen: CRMP1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001014809
• Gene Symbols: CRMP1
• Immunogen: CRMP1 (NP_001014809.1, 221 a.a. ∼ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 2B6
• Description: Mouse monoclonal antibody raised against a partial recombinant CRMP1.
• Gene: CRMP1
• Gene Alias: DPYSL1/DRP-1/DRP1
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1400
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid