COMT, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human COMT protein.

Brand:  Abnova H00001312-D01.100uL

Product Code. 16126534

Description

Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq

Sequence: MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Specifications

• Antigen: COMT
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human COMT protein.
• Gene: COMT
• Gene Symbols: COMT
• Immunogen: COMT (NP_009294.1, 1 a.a. ∼ 221 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 1312
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Immunoprecipitation, Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_007310.1
• Host Species: Rabbit
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Liquid