contactin associated protein-like 4, Mouse, Clone: 5G1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CNTNAP4.

Marca:  Abnova H00085445-M01A.200uL

Codice prodotto. 16181027

Descrizione

This gene product belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: VLGRILEHSDVDQETALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA

Specifica

• Antigen: contactin associated protein-like 4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_033401
• Gene Symbols: CNTNAP4
• Immunogen: CNTNAP4 (NP_207837, 1145 a.a. ∼ 1244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 85445
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 5G1
• Description: Mouse monoclonal antibody raised against a partial recombinant CNTNAP4.
• Gene: CNTNAP4
• Gene Alias: CASPR4/KIAA1763
• Host Species: Mouse
• Quantity: 200 μL
• Research Discipline: Cell Adhesion
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ