calponin 3, acidic, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CNN3.

Brand:  Abnova H00001266-A01.50uL

Product Code. 16176484

Description

This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. [provided by RefSeq

Sequence: DQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY

Specifications

• Antigen: calponin 3, acidic
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant CNN3.
• Gene: CNN3
• Gene Symbols: CNN3
• Immunogen: CNN3 (NP_001830, 230 a.a. ∼ 329 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001839
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 1266
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.