cerberus 1, cysteine knot superfamily, homolog (Xenopus laevis), Mouse, Clone: 3E11, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CER1.

Brand:  Abnova H00009350-M04.100ug

Product Code. 16100446

Description

This gene encodes a cytokine member of the cysteine knot superfamily, characterized by nine conserved cysteines and a cysteine knot region. The cerberus-related cytokines, together with Dan and DRM/Gremlin, represent a group of bone morphogenetic protein (BMP) antagonists that can bind directly to BMPs and inhibit their activity. [provided by RefSeq

Sequence: HWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVS

Specifications

• Antigen: cerberus 1, cysteine knot superfamily, homolog (Xenopus laevis)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005454
• Gene Symbols: CER1
• Immunogen: CER1 (NP_005445.1, 158 a.a. ∼ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 3E11
• Description: Mouse monoclonal antibody raised against a full length recombinant CER1.
• Gene: CER1
• Gene Alias: DAND4/MGC119894/MGC119895/MGC96951
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 9350
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ