missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDX4, Mouse, Clone: 1E11, Abnova™
Mouse monoclonal antibody raised against a full-length recombinant CDX4.
Brand: Abnova H00001046-M16.100ug
This item is not returnable.
View return policy
Description
Sequence: RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*Specifications
| CDX4 | |
| Monoclonal | |
| Unconjugated | |
| PBS with no preservative; pH 7.4 | |
| NM_005193 | |
| Mouse | |
| Affinity chromatography | |
| RUO | |
| 1046 | |
| Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| Liquid |
| ELISA, Western Blot | |
| 1E11 | |
| Mouse monoclonal antibody raised against a full length recombinant CDX4. | |
| CDX4 | |
| CDX4 | |
| CDX4 (NP_005184, 202 a.a. ∼ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
| 100 μg | |
| Primary | |
| Human, Mouse | |
| Antibody | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction