CDC5 cell division cycle 5-like (S. pombe), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CDC5L.

Brand:  Abnova H00000988-A01.50uL

Product Code. 16176004

Description

The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing. [provided by RefSeq

Sequence: ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF

Specifications

• Antigen: CDC5 cell division cycle 5-like (S. pombe)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant CDC5L.
• Gene: CDC5L
• Gene Alias: CEF1/KIAA0432/PCDC5RP/dJ319D22.1/hCDC5
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 988
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001253
• Gene Symbols: CDC5L
• Immunogen: CDC5L (NP_001244, 719 a.a. ∼ 802 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum