CD3G, Mouse, Clone: 2A6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CD3G.

Brand:  Abnova H00000917-M01.100ug

Product Code. 16125794

Description

The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. [provided by RefSeq

Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN

Specifications

• Antigen: CD3G
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000073
• Gene Symbols: CD3G
• Immunogen: CD3G (NP_000064, 23 a.a. ∼ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA
• Clone: 2A6
• Description: Mouse monoclonal antibody raised against a partial recombinant CD3G.
• Gene: CD3G
• Gene Alias: CD3-GAMMA/FLJ17620/FLJ17664/FLJ79544/FLJ94613/MGC138597/T3G
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 917
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid