CD14, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CD14 protein.

Brand:  Abnova H00000929-D01.100uL

Product Code. 16175814

Description

CD14 is a surface protein preferentially expressed on monocytes/macrophages. It binds lipopolysaccharide binding protein and recently has been shown to bind apoptotic cells. Alternative splicing results in multiple transcript variants encoding the same isoform. [provided by RefSeq

Sequence: MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA

Specifications

• Antigen: CD14
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CD14 protein.
• Gene: CD14
• Gene Symbols: CD14
• Immunogen: CD14 (AAH10507.1, 1 a.a. ∼ 375 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 929
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Immunoprecipitation, Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_000591
• Host Species: Rabbit
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid