cancer susceptibility candidate 3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CASC3.

Brand:  Abnova H00022794-A01.50uL

Product Code. 16154126

Description

The product of this gene is a core component of the exon junction complex (EJC), a protein complex that is deposited on spliced mRNAs at exon-exon junctions and functions in nonsense-mediated mRNA decay (NMD). The encoded protein binds RNA and interacts with two other EJC core components. It is predominantly located in the cytoplasm, but shuttles into the nucleus where it localizes to nuclear speckles. [provided by RefSeq

Sequence: VSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS

Specifications

• Antigen: cancer susceptibility candidate 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant CASC3.
• Gene: CASC3
• Gene Alias: BTZ/MLN51
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 22794
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_007359
• Gene Symbols: CASC3
• Immunogen: CASC3 (NP_031385, 604 a.a. ∼ 703 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum