complement component 1, q subcomponent binding protein, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant C1QBP.

Brand:  Abnova H00000708-A01.50uL

Product Code. 16165364

Description

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq

Sequence: IKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Specifications

• Antigen: complement component 1, q subcomponent binding protein
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant C1QBP.
• Gene: C1QBP
• Gene Alias: GC1QBP/HABP1/SF2p32/gC1Q-R/gC1qR/p32
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001212
• Gene Symbols: C1QBP
• Immunogen: C1QBP (NP_001203, 173 a.a. ∼ 282 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 708
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.