chromosome 15 open reading frame 29, Mouse, Clone: 1E7, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant C15orf29.

Brand:  Abnova H00079768-M01A.200uL

Product Code. 16174453

Description

Sequence: MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVKSPDKLRKVIYRRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRTYLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQEEKQYISLGCCVDLLPLVKSLLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQENHLTLVPGYTGNIAKDVDAYLLQLH

Specifications

• Antigen: chromosome 15 open reading frame 29
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC026234
• Gene Symbols: C15orf29
• Immunogen: C15orf29 (AAH26234.1, 1 a.a. ∼ 304 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ

• Applications: ELISA, Western Blot
• Clone: 1E7
• Description: Mouse monoclonal antibody raised against a full length recombinant C15orf29.
• Gene: C15orf29
• Gene Alias: FLJ22557/MGC117356
• Host Species: Mouse
• Quantity: 200 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 79768
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites