missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16188505

breast cancer anti-estrogen resistance 3, Mouse, Clone: 3G4, Abnova™

Product Code. 16188505
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16188505 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16188505 Supplier Abnova Supplier No. H00008412M01.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse monoclonal antibody raised against a partial recombinant BCAR3.

Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. [provided by RefSeq

Sequence: YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA

Specifications

Antigen breast cancer anti-estrogen resistance 3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3G4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant BCAR3.
Formulation PBS with no preservative; pH 7.4
Gene BCAR3
Gene Accession No. BC039895
Gene Alias KIAA0554/NSP2/SH2D3B
Gene Symbols BCAR3
Host Species Mouse
Immunogen BCAR3 (AAH39895, 266 a.a. ∼ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Primary or Secondary Primary
Gene ID (Entrez) 8412
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.