basic leucine zipper transcription factor, ATF-like, Mouse, Clone: 1G4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant BATF.

Brand:  Abnova H00010538-M03.100ug

Product Code. 16102746

Description

The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq

Sequence: EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP

Specifications

• Antigen: basic leucine zipper transcription factor, ATF-like
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006399
• Gene Symbols: BATF
• Immunogen: BATF (NP_006390, 34 a.a. ∼ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 1G4
• Description: Mouse monoclonal antibody raised against a partial recombinant BATF.
• Gene: BATF
• Gene Alias: B-ATF/BATF1/SFA-2/SFA2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 10538
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ