BARX homeobox 1, Mouse, Clone: 1E7, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant BARX1.

Brand:  Abnova H00056033-M01.100ug

Product Code. 16192023

Description

This gene encodes a member of the Bar subclass of homeobox transcription factors. Studies of the mouse and chick homolog suggest the encoded protein may play a role in developing teeth and craniofacial mesenchyme of neural crest origin. The protein may also be associated with differentiation of stomach epithelia. [provided by RefSeq

Sequence: MGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED

Specifications

• Antigen: BARX homeobox 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC009458
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 56033
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 1E7
• Description: Mouse monoclonal antibody raised against a full length recombinant BARX1.
• Gene: BARX1
• Gene Symbols: BARX1
• Immunogen: BARX1 (AAH09458, 1 a.a. ∼ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody