BAI2, Mouse, Clone: 6A12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant BAI2.

Brand:  Abnova H00000576-M01.100ug

Product Code. 16175144

Description

BAI1, a p53-target gene, encodes brain-specific angiogenesis inhibitor, a seven-span transmembrane protein and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are similar to BAI1 in structure, have similar tissue specificities and may also play a role in angiogenesis. [provided by RefSeq

Sequence: DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ

Specifications

• Antigen: BAI2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001703
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 576
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid

• Applications: ELISA, Western Blot
• Clone: 6A12
• Description: Mouse monoclonal antibody raised against a partial recombinant BAI2.
• Gene: BAI2
• Gene Symbols: BAI2
• Immunogen: BAI2 (NP_001694, 22 a.a. ∼ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG3 κ