ATP13A2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ATP13A2.

Brand:  Abnova H00023400-A01.50uL

Product Code. 16174626

Description

This gene encodes a member of the P5 subfamily of ATPases which transports inorganic cations as well as other substrates. Mutations in this gene are associated with Kufor-Rakeb syndrome (KRS), also referred to as Parkinson disease 9. Multiple transcript variants encoding different isoforms have been found for this gene

Sequence: KPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEA

Specifications

• Antigen: ATP13A2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ATP13A2.
• Gene: ATP13A2
• Gene Alias: FLJ26510/HSA9947/KRPPD/PARK9
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_022089
• Gene Symbols: ATP13A2
• Immunogen: ATP13A2 (NP_071372, 68 a.a. ∼ 154 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 23400
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.