ASCL1, Mouse, Clone: 1C5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ASCL1.

Brand:  Abnova H00000429-M04.100ug

Product Code. 16134934

Description

This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq]

Sequence: GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF

Specifications

• Antigen: ASCL1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004316
• Gene Symbols: ASCL1
• Immunogen: ASCL1 (NP_004307, 137 a.a. ∼ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, Western Blot
• Clone: 1C5
• Description: Mouse monoclonal antibody raised against a partial recombinant ASCL1.
• Gene: ASCL1
• Gene Alias: ASH1/HASH1/MASH1/bHLHa46
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 429
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid