actin related protein 2/3 complex, subunit 5, 16kDa, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant ARPC5.

Brand:  Abnova H00010092-A01.50uL

Product Code. 16174472

Description

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. [provided by RefSeq

Sequence: MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

Specifications

• Antigen: actin related protein 2/3 complex, subunit 5, 16kDa
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length recombinant ARPC5.
• Gene: ARPC5
• Gene Alias: ARC16/MGC88523/dJ127C7.3/p16-Arc
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 10092
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC057237
• Gene Symbols: ARPC5
• Immunogen: ARPC5 (AAH57237, 1 a.a. ∼ 154 a.a) full-length recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum