Rho GDP dissociation inhibitor (GDI) alpha, Mouse, Clone: 1E12-2G11, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant ARHGDIA.

Brand:  Abnova H00000396-M01.100ug

Product Code. 16161851

Description

Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al., 1993 [PubMed 8262133]).[supplied by OMIM

Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD

Specifications

• Antigen: Rho GDP dissociation inhibitor (GDI) alpha
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC016031
• Gene Symbols: ARHGDIA
• Immunogen: ARHGDIA (AAH16031, 1 a.a. ∼ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA
• Clone: 1E12-2G11
• Description: Mouse monoclonal antibody raised against a full length recombinant ARHGDIA.
• Gene: ARHGDIA
• Gene Alias: GDIA1/MGC117248/RHOGDI/RHOGDI-1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 396
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ