ARHGAP4, Mouse, Clone: 3F7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ARHGAP4.

Brand:  Abnova H00000393-M01.100ug

Product Code. 16174854

Description

This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to the Golgi complex and can redistribute to microtubules. The rat protein stimulates the activity of some Rho GTPases in vitro. Genomic deletions of this gene and a neighboring gene have been found in patients with nephrogenic diabetes insipidus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: TSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH

Specifications

• Antigen: ARHGAP4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC052303
• Gene Symbols: ARHGAP4
• Immunogen: ARHGAP4 (AAH52303, 881 a.a. ∼ 986 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 3F7
• Description: Mouse monoclonal antibody raised against a partial recombinant ARHGAP4.
• Gene: ARHGAP4
• Gene Alias: C1/KIAA0131/RGC1/RhoGAP4/p115
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 393
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid